PDB entry 3fyg

View 3fyg on RCSB PDB site
Description: crystal structure of tetradeca-(3-fluorotyrosyl)-glutathione s-transferase
Class: transferase
Keywords: transferase, 3-fluorotyrosine, unnatural amino acid, three-dimensional structure, detoxification enzyme
Deposited on 1997-08-07, released 1999-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mu class tetradeca-(3-fluorotyrosyl)-glutathione s-transferase of isoenzyme
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA INSERT OF CLONE PGT33M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04905 (0-216)
      • engineered (5)
      • engineered (21)
      • engineered (26)
      • engineered (31)
      • engineered (39)
      • engineered (60)
      • engineered (77)
      • engineered (136)
      • engineered (153)
      • engineered (159)
      • engineered (165)
      • engineered (195)
      • engineered (201)
    Domains in SCOPe 2.07: d3fyga1, d3fyga2
  • Chain 'B':
    Compound: mu class tetradeca-(3-fluorotyrosyl)-glutathione s-transferase of isoenzyme
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CDNA INSERT OF CLONE PGT33M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04905 (0-216)
      • engineered (5)
      • engineered (21)
      • engineered (26)
      • engineered (31)
      • engineered (39)
      • engineered (60)
      • engineered (77)
      • engineered (136)
      • engineered (153)
      • engineered (159)
      • engineered (165)
      • engineered (195)
      • engineered (201)
    Domains in SCOPe 2.07: d3fygb1, d3fygb2
  • Heterogens: GPR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fygA (A:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fygB (B:)
    pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
    ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcynpdfe
    kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
    kdflarfeglkkisaymkssrylstpifsklaqwsnk