PDB entry 3fyd

View 3fyd on RCSB PDB site
Description: Crystal Structure of Dim1 from the thermophilic archeon, Methanocaldococcus jannaschi
Class: transferase
Keywords: dimethyladenosine transferase, rossmann fold, rRNA methylase, ribosomal assembly, Methyltransferase, RNA-binding, rRNA processing, S-adenosyl-L-methionine, Transferase
Deposited on 2009-01-22, released 2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable dimethyladenosine transferase
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: ksgA, MJ1029
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q58435 (0-262)
    • engineered (127-128)
  Domains in SCOPe 2.08: d3fyda_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fydA (A:)
  qcflidknfvnkavesanltkddvvleiglgkgilteelaknakkvyvieidkslepyan
  klkelynnieiiwgdalkvdlnkldfnkvvanlpyqisspitfklikrgfdlavlmyqye
  fakrmvaaagtkdygrlsvavqsradveivakvppsafypkpkvysaivkikpnkgkyhi
  enenffddflraifqhrnksvrkalidsskelnynkdemkkiledflntnseiknlinek
  vfklsvkdivnlsnefyrflqnr