PDB entry 3fy9

View 3fy9 on RCSB PDB site
Description: Staph. aureus DHFR F98Y complexed with AR-102
Class: oxidoreductase
Keywords: DHFR, AR-102, OXIDOREDUCTASE, NADP, One-carbon metabolism
Deposited on 2009-01-22, released 2009-08-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A017 (0-End)
      • engineered (97)
    Domains in SCOPe 2.06: d3fy9x_
  • Heterogens: NAP, XCF, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3fy9X (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fy9X (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirk