PDB entry 3fy5

View 3fy5 on RCSB PDB site
Description: Dishevelled PDZ domain homodimer
Class: protein binding
Keywords: PDZ, dishevelled, cell polarity, Cell membrane, Cell projection, Cilium, Cilium biogenesis/degradation, Cytoplasm, Cytoplasmic vesicle, Developmental protein, Gastrulation, Membrane, Nucleus, Phosphoprotein, Wnt signaling pathway, PROTEIN BINDING
Deposited on 2009-01-21, released 2009-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Segment polarity protein dishevelled homolog DVL-2
  Species: Xenopus laevis [TaxId:8355]
  Gene: dsh, dvl2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51142 (1-90)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d3fy5a_
• Chain 'B':
  Compound: Segment polarity protein dishevelled homolog DVL-2
  Species: Xenopus laevis [TaxId:8355]
  Gene: dsh, dvl2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51142 (1-End)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d3fy5b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fy5A (A:)
  mtvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndinf
  enmsnddavrvlrdivhkpgpivltvakcwd
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3fy5B (B:)
  mtvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndinf
  enmsnddavrvlrdivhkpgpivltvakcwd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3fy5B (B:)
  mtvtlnmekynflgisivgqsnggiyigsimkggavaadgriepgdmllqvndinfenms
  nddavrvlrdivhkpgpivltvakc