PDB entry 3fxw

View 3fxw on RCSB PDB site
Description: High resolution crystal structure of mitogen-activated protein kinase-activated protein kinase 3/inhibitor 2 complex
Class: transferase
Keywords: Kinase domain fold, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-01-21, released 2010-01-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3fxwa_
  • Heterogens: F10, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fxwA (A:)
    mahhhhhhssglevlfqgpepkkyavtddyqlskqvlglgvngkvlecfhrrtgqkcalk
    llydspkarqevdhhwqasggphivcildvyenmhhgkrclliimecmeggelfsriqer
    gdqaftereaaeimrdigtaiqflhshniahrdvkpenllytskekdavlkltdfgfake
    ttqnalqtpcytpyyvapevlgpekydkscdmwslgvimyillcgfppfysntgqaispg
    mkrrirlgqygfpnpewsevsedakqlirlllktdpterltitqfmnhpwinqsmvvpqt
    plhtarvlqedkdhwdevkeemtsalatmrvdydqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fxwA (A:)
    epkkyavtddyqlskqvlglgvgkvlecfhrrtgqkcalkllydspkarqevdhhwqasg
    gphivcildvyenmhhgkrclliimecmeggelfsriqerdqaftereaaeimrdigtai
    qflhshniahrdvkpenllytskekdavlkltdfgfakeekydkscdmwslgvimyillc
    gfppfgfpnpewsevsedakqlirlllktdpterltitqfmnhpwinqsmvvpqtplhta
    rvlqedkdhwdevkeemtsalatmrvdydqv