PDB entry 3fxv

View 3fxv on RCSB PDB site
Description: Identification of an N-oxide pyridine GW4064 analogue as a potent FXR agonist
Class: hormone receptor
Keywords: NUCLEAR RECEPTOR, CHOLESTEROL, BILE ACID, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, Activator, Acyltransferase, Alternative splicing, Chromosomal rearrangement, Phosphoprotein, Polymorphism, Proto-oncogene, Transferase, Ubl conjugation, hormone receptor
Deposited on 2009-01-21, released 2009-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NR1H4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H4, hCG_20893
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1L4K5 (4-231)
      • expression tag (3)
      • engineered (37)
      • engineered (110)
    Domains in SCOPe 2.08: d3fxva1, d3fxva2
  • Chain 'B':
    Compound: 12-meric peptide from Nuclear receptor coactivator 1
    Species: Homo sapiens, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 643, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fxvA (A:)
    gshmeltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlv
    eftkklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisd
    eyitpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklc
    kihqpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fxvA (A:)
    meltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveft
    kklpgfqtldhedqiallkgsaveamflrsaeifnkhsdllearirnsgisdeyitpmfs
    fyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqpenp
    qhfacllgrltelrtfnhhhaemlmswrvhkftpllceiwdv
    

  • Chain 'B':
    No sequence available.