PDB entry 3fxn

View 3fxn on RCSB PDB site
Description: structure of the semiquinone form of flavodoxin from clostridium mp. extension of 1.8 angstroms resolution and some comparisons with the oxidized state
Deposited on 1977-12-16, released 1978-03-16
The last revision was dated 1984-05-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FMN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >3fxn_ (-)
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani

  • Chain 'p':
    No sequence available.