PDB entry 3fxc

View 3fxc on RCSB PDB site
Description: x-*ray analysis of a (2*fe-2*s) ferredoxin from spirulina $platensis. main chain fold and location of side chains at 2.5 angstroms resolution
Deposited on 1981-12-07, released 1982-02-03
The last revision was dated 1984-10-22, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FES

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >3fxc_ (-)
atykvtlineaeginetidcdddtyildaaeeagldlpyscragacstcagtitsgtidq
sdqsfldddqieagyvltcvayptsdctikthqeegly

  • Chain 'p':
    No sequence available.