PDB entry 3fx2

View 3fx2 on RCSB PDB site
Description: comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
Deposited on 1991-10-17, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3fx2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fx2_ (-)
    akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai