PDB entry 3fww

View 3fww on RCSB PDB site
Description: The crystal structure of the bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase from Yersinia pestis CO92
Class: transferase
Keywords: N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase, structural genomics, CSGID, Acyltransferase, Cell shape, Cell wall biogenesis/degradation, Magnesium, Metal-binding, Multifunctional enzyme, Nucleotidyltransferase, Peptidoglycan synthesis, Transferase, Center for Structural Genomics of Infectious Diseases
Deposited on 2009-01-19, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Yersinia pestis Pestoides F [TaxId:386656]
    Gene: gi: 16124227, glmU, YPDSF_3916
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fwwa1, d3fwwa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fwwA (A:)
    msnssmsvvilaagkgtrmysdlpkvlhplagkpmvqhvidaamklgaqhvhlvyghgge
    llkktladpslnwvlqaeqlgtghamqqaaphfaddedilmlygdvplisvdtlqrllaa
    kpeggiglltvkldnpsgygrivrengdvvgivehkdasdaqreineintgilvangrdl
    krwlslldnnnaqgefyitdiialahadgkkiatvhptrlsevegvnnrlqlsalervfq
    teqaeklllagvmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkn
    cvigddseispytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgsk
    aghlsylgdaeigagvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvangat
    igagttvtrdvaenelvisrvkqvhiqgwkrpvkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fwwA (A:)
    ssmsvvilaagkgtrmysdlpkvlhplagkpmvqhvidaamklgaqhvhlvyghggellk
    ktladpslnwvlqaeqlgtghamqqaaphfaddedilmlygdvplisvdtlqrllaakpe
    ggiglltvkldnpsgygrivrengdvvgivehkdasdaqreineintgilvangrdlkrw
    lslldnnqgefyitdiialahadgkkiatvhptrlsevegvnnrlqlsalervfqteqae
    klllagvmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigd
    dseispytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghls
    ylgdaeigagvnigagtitcnydnkfktiigddvfvgsdtqlvapvtvangatigagttv
    trdvaenelvisrvkqvhiqgwkrp