PDB entry 3fwv

View 3fwv on RCSB PDB site
Description: crystal structure of a redesigned tpr protein, t-mod(vmy), in complex with meevf peptide
Deposited on 2009-01-19, released 2009-04-21
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hsc70/Hsp90-organizing protein
    Species: Homo sapiens [TaxId:9606]
    Gene: STIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31948 (1-127)
      • expression tag (0)
      • engineered mutation (41)
      • engineered mutation (76)
      • engineered mutation (79)
      • engineered mutation (112)
  • Chain 'B':
    Compound: Hsc70/Hsp90-organizing protein
    Species: Homo sapiens [TaxId:9606]
    Gene: STIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31948 (1-127)
      • expression tag (0)
      • engineered mutation (41)
      • engineered mutation (76)
      • engineered mutation (79)
      • engineered mutation (112)
  • Chain 'C':
    Compound: heat shock protein hsp 90-beta
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08238 (0-4)
      • engineered mutation (4)
  • Chain 'D':
    Compound: heat shock protein hsp 90-beta
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08238 (0-4)
      • engineered mutation (4)
  • Heterogens: NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fwvA (A:)
skqalkekelgndaykkkdfdtalkhydkakeldptnmtyivnqaavyfekgdynkcrel
cekaievgrenredyrmiayayarignsyfkeekykdaihfynkslaehrtpkvlkkcqq
aekilkeq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3fwvB (B:)
skqalkekelgndaykkkdfdtalkhydkakeldptnmtyivnqaavyfekgdynkcrel
cekaievgrenredyrmiayayarignsyfkeekykdaihfynkslaehrtpkvlkkcqq
aekilkeq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3fwvC (C:)
meevf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3fwvD (D:)
meevf