PDB entry 3fws

View 3fws on RCSB PDB site
Description: Crystal Structure of the CBS domains from the Bacillus subtilis CcpN repressor complexed with AppNp, phosphate and magnesium ions
Class: transcription
Keywords: CBS DOMAIN DIMER, Metabolism regulator, Central glycolytic gene regulator, TRANSCRIPTION
Deposited on 2009-01-19, released 2010-01-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YqzB protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yqzB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: YqzB protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yqzB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3fwsb_
  • Heterogens: ANP, PO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fwsB (B:)
    mtgktgtqlladklkklqvkdfqsipvvihenvsvydaictmfledvgtlfvvdrdavlv
    gvlsrkdllrasigqqeltsvpvhiimtrmpnitvcrredyvmdiakhliekqidalpvi
    kdtdkgfevigrvtktnmtkilvslseneillqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fwsB (B:)
    gktgtqlladklkklqvkdfqsipvvihenvsvydaictmfledvgtlfvvdrdavlvgv
    lsrkdllrasigqqeltsvpvhiimtrmpnitvcrredyvmdiakhliekqidalpvikd
    tdkgfevigrvtktnmtkilvslsen