PDB entry 3fwg

View 3fwg on RCSB PDB site
Description: Ferric camphor bound Cytochrome P450cam, Arg365Leu, Glu366Gln, monoclinic crystal form
Class: oxidoreductase
Keywords: Hemoprotein, Cytochrome P450, Cytochrome, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2009-01-18, released 2009-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-404)
      • see remark 999 (266)
      • engineered (355-356)
    Domains in SCOPe 2.07: d3fwga_
  • Chain 'B':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (0-404)
      • see remark 999 (266)
      • engineered (355-356)
    Domains in SCOPe 2.07: d3fwgb_
  • Heterogens: HEM, CAM, TRS, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fwgA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarlqiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fwgA (A:)
    laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
    ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
    iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
    mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
    dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv
    qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarlqiivt
    lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fwgB (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarlqiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav