PDB entry 3fw5

View 3fw5 on RCSB PDB site
Description: Crystal structure of Siderocalin (NGAL, Lipocalin 2) complexed with Ferric 4-methyl-catechol
Class: transport protein
Keywords: 8-stranded anti-parallel beta barrel, 310-helix, Glycoprotein, Pyrrolidone carboxylic acid, Secreted, TRANSPORT PROTEIN
Deposited on 2009-01-16, released 2010-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.248
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: HNL, LCN2, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188 (Start-177)
      • engineered (86)
    Domains in SCOPe 2.07: d3fw5a_
  • Chain 'B':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: HNL, LCN2, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered (86)
    Domains in SCOPe 2.07: d3fw5b_
  • Chain 'C':
    Compound: Neutrophil gelatinase-associated lipocalin
    Species: Homo sapiens [TaxId:9606]
    Gene: HNL, LCN2, NGAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188
      • engineered (86)
    Domains in SCOPe 2.07: d3fw5c_
  • Heterogens: FE, MCT, NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fw5A (A:)
    qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
    dksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqham
    vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fw5A (A:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
    ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
    kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fw5B (B:)
    qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
    dksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqham
    vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fw5B (B:)
    sdlipapplskvplqqnfqdnqfqgkwyvvglagnailqkmyatiyelkdksynvtsvlf
    rkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvsqnre
    yfkitlygrtkelkenfirfsksglpenhivfpvpidqcid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fw5C (C:)
    qdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelke
    dksynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqham
    vffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fw5C (C:)
    tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
    ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
    kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid