PDB entry 3fw0

View 3fw0 on RCSB PDB site
Description: Structure of Peptidyl-alpha-hydroxyglycine alpha-Amidating Lyase (PAL) bound to alpha-hydroxyhippuric acid (non-peptidic substrate)
Deposited on 2009-01-16, released 2009-09-01
The last revision was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14925 (6-328)
      • expression tag (0-5)
  • Heterogens: HG, CA, HH3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fw0A (A:)
hhhhhhdfhveeeldwpgvyllpgqvsgvaldsknnlvifhrgdhvwdgnsfdskfvyqq
rglgpieedtilvidpnnaeilqssgknlfylphglsidtdgnywvtdvalhqvfkldph
skegpllilgrsmqpgsdqnhfcqptdvavepstgavfvsdgycnsrivqfspsgkfvtq
wgeessgssprpgqfsvphslalvphldqlcvadrengriqcfktdtkefvreikhasfg
rnvfaisyipgflfavngkpyfgdqepvqgfvmnfssgeiidvfkpvrkhfdmphdivas
edgtvyigdahtntvwkftltekmehrsv