PDB entry 3fvj

View 3fvj on RCSB PDB site
Description: Crystal structure of phospholipase A2 1B crystallized in the presence of octyl sulfate
Class: hydrolase
Keywords: Phospholipase A2, Pla2-1B, octyl sulfate binding, Hydrolase, Lipid degradation, Lipoprotein, Metal-binding, Palmitate, Pyrrolidone carboxylic acid, Secreted
Deposited on 2009-01-15, released 2010-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fvja_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fvjA (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc