PDB entry 3fug

View 3fug on RCSB PDB site
Description: Crystal Structure of the Retinoid X Receptor Ligand Binding Domain Bound to the Synthetic Agonist 3-[4-Hydroxy-3-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydronaphthalen-2-yl)-phenyl]acrylic Acid
Class: Transcription/Transcription regulator
Keywords: PROTEIN-LIGAND COMPLEX, HORMONE RECEPTOR, DNA-binding, Host-virus interaction, Metal-binding, Nucleus, Polymorphism, Receptor, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger, Activator, Phosphoprotein, Transcription/Transcription regulator COMPLEX
Deposited on 2009-01-14, released 2009-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Retinoic acid receptor RXR-alpha
  Species: Homo sapiens [TaxId:9606]
  Gene: NR2B1, RXRA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19793
  Domains in SCOPe 2.08: d3fuga_
• Chain 'B':
  Compound: nuclear receptor coactivator 2
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15596
• Heterogens: 2E3, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3fugA (A:)
  tssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvew
  akriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagv
  gaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyaslea
  yckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3fugA (A:)
  dmpverileaelavedpvtnicqaadkqlftlvewakriphfselplddqvillragwne
  lliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktel
  gclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrs
  iglkclehlfffkligdtpidtflmemleap
  

  
  
• Chain 'B':
  No sequence available.