PDB entry 3fua

View 3fua on RCSB PDB site
Description: l-fuculose-1-phosphate aldolase crystal form k
Deposited on 1996-02-14, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.184
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3fua__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fua_ (-)
    mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
    ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
    nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
    ylttlaitdpvpvlsdeeiavvlekf