PDB entry 3fu1

View 3fu1 on RCSB PDB site
Description: crystal structure of the major pseudopilin from the type 2 secretion system of vibrio cholerae
Deposited on 2009-01-13, released 2009-07-28
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General secretion pathway protein G
    Species: Vibrio cholerae [TaxId:666]
    Gene: epsG, VC_2730
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45773 (3-114)
      • expression tag (0-2)
  • Chain 'B':
    Compound: General secretion pathway protein G
    Species: Vibrio cholerae [TaxId:666]
    Gene: epsG, VC_2730
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fu1A (A:)
gamgnkekadqqkavtdivalenaldmykldnsvypttdqglealvtkptnpeprnyreg
gyikrlpkdpwgndyqylspgdkgtidvftlgadgqeggegtgadignwniqdfq

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3fu1B (B:)
gamgnkekadqqkavtdivalenaldmykldnsvypttdqglealvtkptnpeprnyreg
gyikrlpkdpwgndyqylspgdkgtidvftlgadgqeggegtgadignwniqdfq

    Sequence, based on observed residues (ATOM records):
    >3fu1B (B:)
gnkekadqqkavtdivalenaldmykldnsvypttdqglealvtkptnpeprnyreggyi
krlpkdpwgndyqylspgdkgtidvftlgadgqeggegtgadignwniqdfq