PDB entry 3ftp

View 3ftp on RCSB PDB site
Description: Crystal structure of 3-Ketoacyl-(acyl-carrier-protein) reductase from Burkholderia pseudomallei at 2.05 A resolution
Class: oxidoreductase
Keywords: SSGCID, BURKHOLDERIA PSEUDOMALLEI, 3-KETOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE, Oxidoreductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2009-01-13, released 2009-01-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.211
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabG, BPSL2440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ftpa_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabG, BPSL2440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ftpb_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabG, BPSL2440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ftpc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabG, BPSL2440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ftpd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ftpA (A:)
    mahhhhhhmgtleaqtqgpgsmdktldkqvaivtgasrgigraialelarrgamvigtat
    teagaegigaafkqaglegrgavlnvndatavdalvestlkefgalnvlvnnagitqdql
    amrmkddewdavidtnlkavfrlsravlrpmmkarggrivnitsvvgsagnpgqvnyaaa
    kagvagmtralareigsrgitvncvapgfidtdmtkglpqeqqtalktqiplgrlgsped
    iahavaflaspqagyitgttlhvnggmfms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ftpA (A:)
    dktldkqvaivtgasrgigraialelarrgamvigtatteagaegigaafkqaglegrga
    vlnvndatavdalvestlkefgalnvlvnnagitqdqlamrmkddewdavidtnlkavfr
    lsravlrpmmkarggrivnitsvvgsagnpgqvnyaaakagvagmtralareigsrgitv
    ncvapgfidtdmtkglpqeqqtalktqiplgrlgspediahavaflaspqagyitgttlh
    vnggmfms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ftpB (B:)
    mahhhhhhmgtleaqtqgpgsmdktldkqvaivtgasrgigraialelarrgamvigtat
    teagaegigaafkqaglegrgavlnvndatavdalvestlkefgalnvlvnnagitqdql
    amrmkddewdavidtnlkavfrlsravlrpmmkarggrivnitsvvgsagnpgqvnyaaa
    kagvagmtralareigsrgitvncvapgfidtdmtkglpqeqqtalktqiplgrlgsped
    iahavaflaspqagyitgttlhvnggmfms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ftpB (B:)
    dktldkqvaivtgasrgigraialelarrgamvigtatteagaegigaafkqaglegrga
    vlnvndatavdalvestlkefgalnvlvnnagitqdqlamrmkddewdavidtnlkavfr
    lsravlrpmmkarggrivnitsvvgsagnpgqvnyaaakagvagmtralareigsrgitv
    ncvapgfidtdmtkglpqeqqtalktqiplgrlgspediahavaflaspqagyitgttlh
    vnggmfms
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ftpC (C:)
    mahhhhhhmgtleaqtqgpgsmdktldkqvaivtgasrgigraialelarrgamvigtat
    teagaegigaafkqaglegrgavlnvndatavdalvestlkefgalnvlvnnagitqdql
    amrmkddewdavidtnlkavfrlsravlrpmmkarggrivnitsvvgsagnpgqvnyaaa
    kagvagmtralareigsrgitvncvapgfidtdmtkglpqeqqtalktqiplgrlgsped
    iahavaflaspqagyitgttlhvnggmfms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ftpC (C:)
    dktldkqvaivtgasrgigraialelarrgamvigtatteagaegigaafkqaglegrga
    vlnvndatavdalvestlkefgalnvlvnnagitqdqlamrmkddewdavidtnlkavfr
    lsravlrpmmkarggrivnitsvvgsagnpgqvnyaaakagvagmtralareigsrgitv
    ncvapgfidtdmtkeqqtalktqiplgrlgspediahavaflaspqagyitgttlhvngg
    mfms
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ftpD (D:)
    mahhhhhhmgtleaqtqgpgsmdktldkqvaivtgasrgigraialelarrgamvigtat
    teagaegigaafkqaglegrgavlnvndatavdalvestlkefgalnvlvnnagitqdql
    amrmkddewdavidtnlkavfrlsravlrpmmkarggrivnitsvvgsagnpgqvnyaaa
    kagvagmtralareigsrgitvncvapgfidtdmtkglpqeqqtalktqiplgrlgsped
    iahavaflaspqagyitgttlhvnggmfms
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ftpD (D:)
    dktldkqvaivtgasrgigraialelarrgamvigtatteagaegigaafkqaglegrga
    vlnvndatavdalvestlkefgalnvlvnnagitqdqlamrmkddewdavidtnlkavfr
    lsravlrpmmkarggrivnitsvvgsagnpgqvnyaaakagvagmtralareigsrgitv
    ncvapgfidtdeqqtalktqiplgrlgspediahavaflaspqagyitgttlhvnggmfm
    s