PDB entry 3ftg

View 3ftg on RCSB PDB site
Description: Crystal Structure of H2Db in complex with NP366-N3A variant peptide from influenza
Class: immune system
Keywords: H2Db, mouse MHC, influenza, immunology, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Immunoglobulin domain, Secreted, IMMUNE SYSTEM
Deposited on 2009-01-12, released 2009-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ftga1, d3ftga2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01887 (1-99)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3ftgb1, d3ftgb2
  • Chain 'C':
    Compound: NP366-N3A variant peptide from influenza virus
    Database cross-references and differences (RAF-indexed):
    • PDB 3FTG (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ftgA (A:)
    mgphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpey
    weretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfaye
    grdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatl
    lrtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdg
    tfqkwasvvvplgkeqnytcrvyheglpepltlrwepppst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ftgA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvtrcwalgfypaditltwqlelvetrpagdgtfqkwasqnytcrvyheglpe
    pltlrwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ftgB (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.