PDB entry 3ft0

View 3ft0 on RCSB PDB site
Description: Pseudomonas aeruginosa Azurin with mutated metal-binding loop sequence (CAAAAHAAAAM), chemically reduced
Class: metal binding protein
Keywords: cupredoxin-fold, metal binding, protein:protein interaction, METAL BINDING PROTEIN
Deposited on 2009-01-12, released 2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-128)
      • see remark 999 (112-120)
    Domains in SCOPe 2.07: d3ft0a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-128)
      • see remark 999 (112-120)
    Domains in SCOPe 2.07: d3ft0b_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ft0A (A:)
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
amkgtltlk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ft0B (B:)
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
amkgtltlk