PDB entry 3fsw

View 3fsw on RCSB PDB site
Description: Pseudomonas aeruginosa Azurin with mutated metal-binding loop sequence (CAAAAHAAAM)
Class: metal binding protein
Keywords: cupredoxin fold, metal-binding, protein:protein interaction, METAL BINDING PROTEIN
Deposited on 2009-01-12, released 2009-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • see remark 999 (112-119)
    Domains in SCOPe 2.07: d3fswa_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • see remark 999 (112-119)
    Domains in SCOPe 2.07: d3fswb_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • see remark 999 (112-119)
    Domains in SCOPe 2.07: d3fswc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-127)
      • see remark 999 (112-119)
    Domains in SCOPe 2.07: d3fswd_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fswA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fswA (A:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaam
    kgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fswB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
    mkgtltlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fswC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fswC (C:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaamkgt
    ltlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fswD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fswD (D:)
    ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvt
    dgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaam
    kgtltlk