PDB entry 3fsn

View 3fsn on RCSB PDB site
Description: Crystal structure of RPE65 at 2.14 angstrom resolution
Class: isomerase
Keywords: 7-bladed beta-propeller, Palmitoylation, Cell membrane, Lipoprotein, Membrane, Palmitate, Sensory transduction, Vision, ISOMERASE, Isomerohydrolase
Deposited on 2009-01-11, released 2009-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinal pigment epithelium-specific 65 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28175 (Start-532)
      • variant (340)
    Domains in SCOPe 2.07: d3fsna_
  • Chain 'B':
    Compound: Retinal pigment epithelium-specific 65 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28175 (Start-532)
      • variant (340)
    Domains in SCOPe 2.07: d3fsnb_
  • Heterogens: FE2, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fsnA (A:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrff
    syfrgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatah
    phiendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyv
    hsfgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyi
    nnkyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarka
    pqpevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpq
    inyqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdale
    eddgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fsnA (A:)
    sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
    gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafevtdnalvniypvg
    edyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfgknf
    siaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvkin
    lfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyed
    heflivdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidkadtg
    knlvtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyayglgln
    hfvpdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpa
    yllilnakdlsevaraeveinipvtfhglfkks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fsnB (B:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrff
    syfrgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatah
    phiendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyv
    hsfgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyi
    nnkyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarka
    pqpevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpq
    inyqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdale
    eddgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fsnB (B:)
    sqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlfd
    gqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpevtdnalvniypv
    gedyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfgkn
    fsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvki
    nlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintye
    dheflivdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidkadt
    gknlvtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyayglgl
    nhfvpdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkp
    ayllilnakdlsevaraeveinipvtfhglfkks