PDB entry 3fsm

View 3fsm on RCSB PDB site
Description: crystal structure of a chemically synthesized 203 amino acid 'covalent dimer' [l-ala51,d-ala51'] hiv-1 protease molecule
Deposited on 2009-01-10, released 2010-01-05
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COVALENT DIMER [L-Ala51, D-Ala51'] HIV-1 PROTEASE
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3FSM (0-202)
  • Heterogens: 2NC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fsmA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiagfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnfcggggpqitlwkrplvtirig
gqlkealldtgaddtvieelnlpgcwkpkliggiagfikvrqydqipveiaghkaigtvl
vgptpvniigrnlltqigatlnf