PDB entry 3fs7

View 3fs7 on RCSB PDB site
Description: Crystal structure of Gallus gallus beta-parvalbumin (avian thymic hormone)
Class: metal binding protein
Keywords: CALCIUM-BINDING PROTEIN, EF-HAND, parvalbumin, Acetylation, Calcium, METAL BINDING PROTEIN
Deposited on 2009-01-09, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.166
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fs7a_
  • Chain 'B':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fs7b_
  • Chain 'C':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fs7c_
  • Chain 'D':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fs7d_
  • Chain 'E':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fs7e_
  • Chain 'F':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fs7f_
  • Chain 'G':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fs7g_
  • Chain 'H':
    Compound: Parvalbumin, thymic
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fs7h_
  • Heterogens: CA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fs7A (A:)
    maitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfie
    eeelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fs7A (A:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fs7B (B:)
    maitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfie
    eeelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fs7B (B:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fs7C (C:)
    maitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfie
    eeelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fs7C (C:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fs7D (D:)
    maitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfie
    eeelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fs7D (D:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3fs7E (E:)
    maitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfie
    eeelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fs7E (E:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3fs7F (F:)
    maitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfie
    eeelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fs7F (F:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3fs7G (G:)
    maitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfie
    eeelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fs7G (G:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3fs7H (H:)
    maitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfie
    eeelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fs7H (H:)
    aitdilsakdiesalsscqaadsfnyksffstvglssktpdqikkvfgildqdksgfiee
    eelqlflknfsssarvltsaetkaflaagdtdgdgkigveefqslvka