PDB entry 3fru

View 3fru on RCSB PDB site
Description: neonatal fc receptor, ph 6.5
Deposited on 1997-12-22, released 1998-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 1998-06-10, with a file datestamp of 1998-06-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.232
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruA (A:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruB (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruC (C:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruD (D:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruE (E:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fruF (F:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm