PDB entry 3frb

View 3frb on RCSB PDB site
Description: S. aureus F98Y DHFR complexed with TMP
Class: oxidoreductase
Keywords: S. aureus DHFR, OXIDOREDUCTASE, NADP, One-carbon metabolism
Deposited on 2009-01-08, released 2010-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.238
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A017 (0-End)
      • engineered (97)
    Domains in SCOPe 2.06: d3frbx_
  • Heterogens: NAP, TOP, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3frbX (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3frbX (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirk