PDB entry 3fra

View 3fra on RCSB PDB site
Description: Staphylococcus aureus F98Y DHFR complexed with iclaprim
Class: oxidoreductase
Keywords: DHFR, OXIDOREDUCTASE, NADP, One-carbon metabolism
Deposited on 2009-01-08, released 2010-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.226
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A017 (0-End)
      • engineered (97)
    Domains in SCOPe 2.07: d3frax_
  • Heterogens: NAP, I2H, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3fraX (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fraX (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirk