PDB entry 3fr8

View 3fr8 on RCSB PDB site
Description: rice Ketolacid reductoisomerase in complex with Mg2+-NADPH
Class: oxidoreductase
Keywords: Rossmann fold, Branched-chain amino acid biosynthesis, Knotted protein, NADPH, Isomerase, OXIDOREDUCTASE
Deposited on 2009-01-08, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ketol-acid reductoisomerase (Os05g0573700 protein)
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: ilvB, OJ1735_C10.18, Os05g0573700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fr8a1, d3fr8a2
  • Chain 'B':
    Compound: Putative ketol-acid reductoisomerase (Os05g0573700 protein)
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: ilvB, OJ1735_C10.18, Os05g0573700
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fr8b1, d3fr8b2
  • Heterogens: MG, SO4, NDP, PE4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fr8A (A:)
    mvaappavgaampsldfdtsvfnkekvslagheeyivrggrnlfpllpeafkgikqigvi
    gwgsqgpaqaqnlrdslaeaksdivvkiglrkgsksfdearaagfteesgtlgdiwetvs
    gsdlvlllisdaaqadnyekifshmkpnsilglshgfllghlqsagldfpknisviavcp
    kgmgpsvrrlyvqgkeingaginssfavhqdvdgratdvalgwsvalgspftfattleqe
    yksdifgergillgavhgivealfrryteqgmdeemaykntvegitgiisktiskkgmle
    vynslteegkkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgnidqtrmwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsyseiin
    esviesvdslnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkdapin
    qdlisnfmsdpvhgaievcaelrptvdisvpanadfvrpelrqss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fr8A (A:)
    aampsldfdtsvfnkekvslagheeyivrggrnlfpllpeafkgikqigvigwgsqgpaq
    aqnlrdslaeaksdivvkiglrkgsksfdearaagfteesgtlgdiwetvsgsdlvllli
    sdaaqadnyekifshmkpnsilglshgfllghlqsagldfpknisviavcpkgmgpsvrr
    lyvqgkeingaginssfavhqdvdgratdvalgwsvalgspftfattleqeyksdifger
    gillgavhgivealfrryteqgmdeemaykntvegitgiisktiskkgmlevynslteeg
    kkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeglpafpmgnidqtr
    mwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsyseiinesviesvds
    lnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkdapinqdlisnfms
    dpvhgaievcaelrptvdisv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fr8B (B:)
    mvaappavgaampsldfdtsvfnkekvslagheeyivrggrnlfpllpeafkgikqigvi
    gwgsqgpaqaqnlrdslaeaksdivvkiglrkgsksfdearaagfteesgtlgdiwetvs
    gsdlvlllisdaaqadnyekifshmkpnsilglshgfllghlqsagldfpknisviavcp
    kgmgpsvrrlyvqgkeingaginssfavhqdvdgratdvalgwsvalgspftfattleqe
    yksdifgergillgavhgivealfrryteqgmdeemaykntvegitgiisktiskkgmle
    vynslteegkkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeglpaf
    pmgnidqtrmwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsyseiin
    esviesvdslnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkdapin
    qdlisnfmsdpvhgaievcaelrptvdisvpanadfvrpelrqss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fr8B (B:)
    pavgaampsldfdtsvfnkekvslagheeyivrggrnlfpllpeafkgikqigvigwgsq
    gpaqaqnlrdslaeaksdivvkiglrkgsksfdearaagfteesgtlgdiwetvsgsdlv
    lllisdaaqadnyekifshmkpnsilglshgfllghlqsagldfpknisviavcpkgmgp
    svrrlyvqgkeingaginssfavhqdvdgratdvalgwsvalgspftfattleqeyksdi
    fgergillgavhgivealfrryteqgmdeemaykntvegitgiisktiskkgmlevynsl
    teegkkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeglpafpmgni
    dqtrmwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsyseiinesvie
    svdslnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkdapinqdlis
    nfmsdpvhgaievcaelrptvdisvpanadfvrpelr