PDB entry 3fr5

View 3fr5 on RCSB PDB site
Description: N-Benzyl-indolo carboxylic acids: Design and synthesis of potent and selective adipocyte Fatty-Acid Binding Protein (A-FABP) inhibitors
Class: lipid binding protein
Keywords: selective adipocyte Fatty-Acid Binding Protein (A-FABP) inhibitors, Cytoplasm, Lipid-binding, Nucleus, Phosphoprotein, Polymorphism, Transport, LIPID BINDING PROTEIN
Deposited on 2009-01-08, released 2009-03-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, adipocyte
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fr5a_
  • Heterogens: I4A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fr5A (A:)
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfknt
eisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmk
gvtstrvyera