PDB entry 3fr3

View 3fr3 on RCSB PDB site
Description: Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
Class: Transferase
Keywords: plasmodium falciparum, pfgst, oxidative stress, Transferase
Deposited on 2009-01-08, released 2010-01-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MU52
      • insertion (113-114)
    Domains in SCOPe 2.04: d3fr3a1, d3fr3a2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8MU52
      • insertion (113-114)
    Domains in SCOPe 2.04: d3fr3b1, d3fr3b2
  • Heterogens: GDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fr3A (A:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntaanettf
    lnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypsslknf
    pllkahnefisnlpniknyitnrkesvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fr3A (A:)
    nivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilq
    igdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntaanettflne
    dlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypsslknfpll
    kahnefisnlpniknyitnrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fr3B (B:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntaanettf
    lnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypsslknf
    pllkahnefisnlpniknyitnrkesvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fr3B (B:)
    nivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilq
    igdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntaanettflne
    dlpkwsgyfekllkknhtnnkyyfvgnnltyadlavfnlyddietkypsslknfpllkah
    nefisnlpniknyitnrk