PDB entry 3fqf

View 3fqf on RCSB PDB site
Description: Staphylococcus aureus F98Y mutant dihydrofolate reductase complexed with NADPH and 2,4-diamino-5-[3-(3,4,5-trimethoxyphenyl)pent-1-ynyl]-6-methylpyrimidine (UCP115A)
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2009-01-07, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trimethoprim-sensitive dihydrofolate reductase
    Species: Staphylococcus aureus RF122 [TaxId:273036]
    Gene: dfrB, SAB1281c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2YY41 (0-156)
      • engineered (97)
    Domains in SCOPe 2.07: d3fqfa_
  • Heterogens: 55V, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fqfA (A:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirk