PDB entry 3fq9

View 3fq9 on RCSB PDB site
Description: Design of an insulin analog with enhanced receptor-binding selectivity. Rationale, structure, and therapeutic implications
Deposited on 2009-01-07, released 2009-08-04
The last revision was dated 2009-11-24, with a file datestamp of 2009-11-20.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.198
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (1-20)
    • insertion (0)
• Chain 'B':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
• Chain 'C':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (1-20)
    • insertion (0)
• Chain 'D':
  Compound: insulin
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
• Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fq9A (A:)
  aiveqccasicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fq9B (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fq9C (C:)
  aiveqccasicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >3fq9D (D:)
  fvnqhlcgshlvealylvcgergffytpkt