PDB entry 3fq1

View 3fq1 on RCSB PDB site
Description: Azurin C112D/M121I
Class: electron transport
Keywords: Electron Transport, Copper Binding, Copper, Metal-binding, Periplasm, Transport
Deposited on 2009-01-06, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (111)
      • engineered (120)
    Domains in SCOPe 2.07: d3fq1a_
  • Heterogens: CU, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fq1A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsal
    ikgtltlk