PDB entry 3fpz

View 3fpz on RCSB PDB site
Description: Saccharomyces cerevisiae THI4p is a suicide thiamin thiazole synthase
Class: biosynthetic protein
Keywords: Thiazole biosynthetic enzyme in yeast, FAD, Mitochondrion, NAD, Thiamine biosynthesis, Transit peptide, BIOSYNTHETIC PROTEIN
Deposited on 2009-01-06, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiazole biosynthetic enzyme
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: THI4, ESP35, MOL1, YGR144W, G6620
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32318 (Start-325)
      • see remark 999 (204)
    Domains in SCOPe 2.07: d3fpza_
  • Chain 'B':
    Compound: Thiazole biosynthetic enzyme
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: THI4, ESP35, MOL1, YGR144W, G6620
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32318 (Start-325)
      • see remark 999 (204)
    Domains in SCOPe 2.07: d3fpzb_
  • Heterogens: AHZ, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fpzA (A:)
    msatstatstsasqlhlnstpvthclsdivkkedwsdfkfapirestvsramtsryfkdl
    dkfavsdviivgagssglsaayviaknrpdlkvciiessvapgggswlggqlfsamvmrk
    pahlflqeleipyedegdyvvvkhaalfistvlskvlqlpnvklfnatcvedlvtrppte
    kgevtvagvvtnwtlvtqahgtqcamdpnvielagykndgtrdlsqkhgvilsttghdgp
    fgafcakrivdidqnqklggmkgldmnhaehdvvihsgayagvdnmyfagmevaeldgln
    rmgptfgamalsgvhaaeqilkhfaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fpzA (A:)
    hlnstpvthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgags
    sglsaayviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyed
    egdyvvvkhaalfistvlskvlqlpnvklfnatcvedlvtrpptekgevtvagvvtnwtl
    vtqahgtqcamdpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidqn
    qklggmkgldmnhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvh
    aaeqilkhfaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fpzB (B:)
    msatstatstsasqlhlnstpvthclsdivkkedwsdfkfapirestvsramtsryfkdl
    dkfavsdviivgagssglsaayviaknrpdlkvciiessvapgggswlggqlfsamvmrk
    pahlflqeleipyedegdyvvvkhaalfistvlskvlqlpnvklfnatcvedlvtrppte
    kgevtvagvvtnwtlvtqahgtqcamdpnvielagykndgtrdlsqkhgvilsttghdgp
    fgafcakrivdidqnqklggmkgldmnhaehdvvihsgayagvdnmyfagmevaeldgln
    rmgptfgamalsgvhaaeqilkhfaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fpzB (B:)
    hlnstpvthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgags
    sglsaayviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipyed
    egdyvvvkhaalfistvlskvlqlpnvklfnatcvedlvtrpptvtvagvvtnwtlvtqa
    hgtqcamdpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidqnqklg
    gmkgldmnhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvhaaeq
    ilkhfaa