PDB entry 3fpy

View 3fpy on RCSB PDB site
Description: Azurin C112D/M121L
Class: electron transport
Keywords: Electron Transport, Copper Binding, Copper, Metal-binding, Periplasm, Transport
Deposited on 2009-01-06, released 2009-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: AZU, PA4922
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-127)
    • engineered (111)
    • engineered (120)
  Domains in SCOPe 2.08: d3fpya_
• Heterogens: CU, TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fpyA (A:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsal
  lkgtltlk