PDB entry 3fpu

View 3fpu on RCSB PDB site
Description: The crystallographic structure of the Complex between Evasin-1 and CCL3
Class: immune system
Keywords: protein:protein complex, chemokine, Glycoprotein, Secreted, Chemotaxis, Cytokine, Inflammatory response, IMMUNE SYSTEM
Deposited on 2009-01-06, released 2010-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.234
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Evasin-1
    Species: Rhipicephalus sanguineus [TaxId:34632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C8E7 (0-93)
      • expression tag (94-99)
  • Chain 'B':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (1-End)
      • engineered (9)
    Domains in SCOPe 2.07: d3fpub_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fpuB (B:)
    mslaadtpttccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fpuB (B:)
    slaadtpttccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdle