PDB entry 3fpi

View 3fpi on RCSB PDB site
Description: Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase IspF complexed with Cytidine Triphosphate
Class: lyase
Keywords: CSGID, alpha-beta sandwich, Isoprene biosynthesis, Lyase, Metal-binding, Structural Genomics, Structural Genomics of National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases
Deposited on 2009-01-05, released 2009-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-03, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.172
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Yersinia pestis [TaxId:214092]
    Gene: ispF, y0829, YPO3360, YPTB0771, YP_0327
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q66EC2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.08: d3fpia1, d3fpia2
  • Heterogens: CTP, EPE, CL, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fpiA (A:)
    snamrighgfdvhkfgengsgpliiggvripyekgllahsdgdvalhaatdallgaaalg
    digklfpdtdpafkgadsrgllreayrrilakgyklgnlditiiaqapkmaphipqmrvn
    laedlqchmddinvkattteqlgftgrgegiaceavvllvnveqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fpiA (A:)
    namrighgfdvhkfgengsgpliiggvripyekgllahsdgdvalhaatdallgaaalgd
    igklfpdtdpafkgadsrgllreayrrilakgyklgnlditiiaqapkmaphipqmrvnl
    aedlqchmddinvkattteqlgftgrgegiaceavvllvnv