PDB entry 3fp7

View 3fp7 on RCSB PDB site
Description: Anionic trypsin variant S195A in complex with bovine pancreatic trypsin inhibitor (BPTI) cleaved at the scissile bond (LYS15-ALA16) determined to the 1.46 A resolution limit
Class: Hydrolase/Hydrolase inhibitor
Keywords: ENZYME-INHIBITOR COMPLEX, PEPTIDE BOND HYDROLYSIS, Calcium, Digestion, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, Pharmaceutical, Protease inhibitor, Serine protease inhibitor, Hydrolase-Hydrolase inhibitor COMPLEX
Deposited on 2009-01-04, released 2009-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Anionic trypsin-2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prss2, Try2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (176)
    Domains in SCOPe 2.08: d3fp7e_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: pancreatic trypsin inhibitor
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, PG4, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fp7E (E:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.