PDB entry 3fp5

View 3fp5 on RCSB PDB site
Description: Crystal structure of ACBP from Moniliophthora perniciosa
Class: lipid binding protein
Keywords: ACBP, Moniliophthora perniciosa, cacao disease, FATTY ACID METABOLISM, LIPID BINDING PROTEIN
Deposited on 2009-01-04, released 2009-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-15, with a file datestamp of 2009-12-11.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.188
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-coa binding protein
    Species: Moniliophthora perniciosa [TaxId:153609]
    Gene: MpACBP
    Database cross-references and differences (RAF-indexed):
    • PDB 3FP5 (0-105)
    Domains in SCOPe 2.08: d3fp5a_
  • Heterogens: ZN, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fp5A (A:)
shmskakfdkaveivqslpkdgpikptqdeqlyfykyfkqatvgdvnisrpglmdftgka
kwdawksvegtskevayqkyveklleilkkadteeskkyiaeieaa