PDB entry 3fop

View 3fop on RCSB PDB site
Description: A Triangular Cytochrome b562 Superstructure Mediated by Ni Coordination - Hexagonal Form
Class: electron transport
Keywords: Four Helix Bundle, Electron transport, Heme, Iron, Metal-binding, Periplasm, Transport
Deposited on 2008-12-30, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fopa_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fopb_
  • Heterogens: HEM, PXX, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fopA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fopB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr