PDB entry 3fon
View 3fon on RCSB PDB site
Description: Crystal structure of the Class I MHC Molecule H-2Kwm7 with a Single Self Peptide VNDIFEAI
Class: immune system
Keywords: Class I MHC, peptide complex, Diabetes-protective Effect, Immune response, Immunoglobulin domain, MHC I, Secreted, IMMUNE SYSTEM
Deposited on
2008-12-30, released
2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-02-05, with a file datestamp of
2020-01-31.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: MHC
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3fonb1, d3fonb2 - Chain 'C':
Compound: MHC
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3fond1, d3fond2 - Chain 'E':
Compound: peptide
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: peptide
Species: synthetic construct, synthetic [TaxId:32630]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3fonB (B:)
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3fonD (D:)
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'E':
No sequence available.
- Chain 'P':
No sequence available.