PDB entry 3fol

View 3fol on RCSB PDB site
Description: Crystal structure of the Class I MHC Molecule H-2Kwm7 with a Single Self Peptide VNDIFERI
Class: immune system
Keywords: Class I MHC, peptide complex, Diabetes-protective Effect, Immune response, Immunoglobulin domain, MHC I, Secreted, Chromosomal protein, DNA-binding, Methylation, Nucleosome core, Nucleus, Phosphoprotein, IMMUNE SYSTEM
Deposited on 2008-12-30, released 2010-01-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MHC
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3FOL (0-273)
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (1-99)
    • expression tag (0)
  Domains in SCOPe 2.02: d3folb_
• Chain 'P':
  Compound: 8 residue synthetic peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3FOL (0-7)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3folB (B:)
  miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
  wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'P':
  No sequence available.