PDB entry 3fol

View 3fol on RCSB PDB site
Description: Crystal structure of the Class I MHC Molecule H-2Kwm7 with a Single Self Peptide VNDIFERI
Class: immune system
Keywords: Class I MHC, peptide complex, Diabetes-protective Effect, Immune response, Immunoglobulin domain, MHC I, Secreted, Chromosomal protein, DNA-binding, Methylation, Nucleosome core, Nucleus, Phosphoprotein, IMMUNE SYSTEM
Deposited on 2008-12-30, released 2010-01-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FOL (0-273)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01887 (1-99)
      • expression tag (0)
    Domains in SCOPe 2.01: d3folb_
  • Chain 'P':
    Compound: 8 residue synthetic peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3FOL (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3folB (B:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.