PDB entry 3foj

View 3foj on RCSB PDB site
Description: Crystal Structure of SSP1007 From Staphylococcus saprophyticus subsp. saprophyticus. Northeast Structural Genomics Target SyR101A.
Deposited on 2008-12-30, released 2009-01-20
The last revision was dated 2009-01-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 [TaxId:342451]
    Gene: SSP1007
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q49YI7 (0-96)
      • expression tag (97-99)
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fojA (A:)
mesitvtelkekildanpvnivdvrtdqetamgiipgaetipmnsipdnlnyfndnetyy
iickaggrsaqvvqyleqngvnavnveggmdefgdegleh