SCOPe 2.08: Structural Classification of Proteins

PDB entry 3foi

View 3foi on RCSB PDB site
Description: fitting of gp18m crystal structure into 3d cryo-em reconstruction of bacteriophage t4 contracted tail
Deposited on 2008-12-30, released 2009-03-10
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: EM
Resolution: 16 Å
R-factor: N/A
AEROSPACI score: -0.15 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Tail sheath protein Gp18
Species: Enterobacteria phage T4 [TaxId:10665]
Gene: 18, GB AAA32541
Database cross-references and differences (RAF-indexed):
- Uniprot P13332 (0-509)
  - see remark 999 (99)
  - see remark 999 (147)
  - see remark 999 (149-150)
  - see remark 999 (300)
  - see remark 999 (398)
  - see remark 999 (453)
  - engineered mutation (509)
Chain 'B':
Compound: Tail sheath protein Gp18
Species: Enterobacteria phage T4 [TaxId:10665]
Gene: 18, GB AAA32541
Database cross-references and differences (RAF-indexed):
- Uniprot P13332 (0-509)
  - see remark 999 (99)
  - see remark 999 (147)
  - see remark 999 (149-150)
  - see remark 999 (300)
  - see remark 999 (398)
  - see remark 999 (453)
  - engineered mutation (509)
Chain 'C':
Compound: Tail sheath protein Gp18
Species: Enterobacteria phage T4 [TaxId:10665]
Gene: 18, GB AAA32541
Database cross-references and differences (RAF-indexed):
- Uniprot P13332 (0-509)
  - see remark 999 (99)
  - see remark 999 (147)
  - see remark 999 (149-150)
  - see remark 999 (300)
  - see remark 999 (398)
  - see remark 999 (453)
  - engineered mutation (509)
Chain 'D':
Compound: Tail sheath protein Gp18
Species: Enterobacteria phage T4 [TaxId:10665]
Gene: 18, GB AAA32541
Database cross-references and differences (RAF-indexed):
- Uniprot P13332 (0-509)
  - see remark 999 (99)
  - see remark 999 (147)
  - see remark 999 (149-150)
  - see remark 999 (300)
  - see remark 999 (398)
  - see remark 999 (453)
  - engineered mutation (509)
Chain 'E':
Compound: Tail sheath protein Gp18
Species: Enterobacteria phage T4 [TaxId:10665]
Gene: 18, GB AAA32541
Database cross-references and differences (RAF-indexed):
- Uniprot P13332 (0-509)
  - see remark 999 (99)
  - see remark 999 (147)
  - see remark 999 (149-150)
  - see remark 999 (300)
  - see remark 999 (398)
  - see remark 999 (453)
  - engineered mutation (509)
Chain 'F':
Compound: Tail sheath protein Gp18
Species: Enterobacteria phage T4 [TaxId:10665]
Gene: 18, GB AAA32541
Database cross-references and differences (RAF-indexed):
- Uniprot P13332 (0-509)
  - see remark 999 (99)
  - see remark 999 (147)
  - see remark 999 (149-150)
  - see remark 999 (300)
  - see remark 999 (398)
  - see remark 999 (453)
  - engineered mutation (509)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence, based on SEQRES records:

>3foiA (A:)
mtllspgielkettvqstvvnnstgtaalagkfqwgpafqikqvtnevdlvntfgqptae
tadyfmsamnflqygndlrvvravdrdtaknsspiagnieytistpgsnyavgdkitvky
vsddietegkitevdadgkikkiniptakiiakakevgeyptlgsnwtaeisssssglaa
vitlgkiitdsgillaeienaeaamtavdfqanlkkygipgvvalypgelgdkieieivs
kadyakgasallpiypgggtrastakavfgygpqtdsqyaiivrrndaivqsvvlstkrg
gkdiydsniyiddffakggseyifataqnwpegfsgiltlsgglssnaevtagdlmeawd
ffadresvdvqlfiagscagesletastvqkhvvsigdvrqdclvlcsppretvvgipvt
ravdnlvnwrtaagsytdnnfnisstyaaidgnykyqydkyndvnrwvplaadiaglcar
tdnvsqtwmspagynrgqilnviklaietp