PDB entry 3fo9

View 3fo9 on RCSB PDB site
Description: Crystal structure of aldolase antibody 33F12 Fab' in complex with hapten 1,3-diketone
Class: immune system
Keywords: aldolase antibody, enamine intermediate, amine catalysis, IMMUNE SYSTEM
Deposited on 2008-12-29, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin IGG2A - light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FO9 (0-218)
    Domains in SCOPe 2.06: d3fo9a1, d3fo9a2
  • Chain 'B':
    Compound: Immunoglobulin IGG2A - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FO9 (0-217)
    Domains in SCOPe 2.06: d3fo9b1, d3fo9b2
  • Chain 'H':
    Compound: Immunoglobulin IGG2A - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FO9 (0-217)
    Domains in SCOPe 2.06: d3fo9h1, d3fo9h2
  • Chain 'L':
    Compound: Immunoglobulin IGG2A - light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FO9 (0-218)
    Domains in SCOPe 2.06: d3fo9l1, d3fo9l2
  • Heterogens: DIK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fo9A (A:)
    elvmtqtplslpvslgdqasiscrssqslvhsygntflnwylqksgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fo9B (B:)
    evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
    hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fo9H (H:)
    evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
    hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsaak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fo9L (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsygntflnwylqksgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec