PDB entry 3fo7

View 3fo7 on RCSB PDB site
Description: Simultaneous inhibition of anti-coagulation and inflammation: Crystal structure of phospholipase A2 complexed with indomethacin at 1.4 A resolution reveals the presence of the new common ligand binding site
Class: Hydrolase
Keywords: PLA2, Anti-inflammatory, Anti-coagulant, Indomethacin, Crystal structure, Hydrolase
Deposited on 2008-12-29, released 2009-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.188
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russelli pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • PDB 3FO7 (0-120)
  Domains in SCOPe 2.08: d3fo7a_
• Heterogens: SO4, IMN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fo7A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c