PDB entry 3fn0

View 3fn0 on RCSB PDB site
Description: Crystal structure of HIV-1 neutralizing human Fab Z13e1 in complex with a 12-residue peptide containing the Z13e1 epitope on gp41
Class: immune system
Keywords: Z13e1, Z13, HIV, ENV, GP41, IMMUNE SYSTEM
Deposited on 2008-12-22, released 2009-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab Z13e1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FN0
  • Chain 'L':
    Compound: Fab Z13e1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FN0 (0-End)
    Domains in SCOPe 2.06: d3fn0l1, d3fn0l2
  • Chain 'P':
    Compound: Envelope polyprotein GP160
    Database cross-references and differences (RAF-indexed):
    • PDB 3FN0 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3fn0L (L:)
    eltqspatlslspgeratlscrasqsvgrnlgwyqqkpgqaprlliydasnratgiparf
    sgsgsgtdftltisslepedfavyycqarlllpqtfgqgtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fn0L (L:)
    eltqspatlslspgeratlscrasqsvgrnlgwyqqkpgqaprlliydasnratgiparf
    sgsgsgtdftltisslepedfavyycqarlllpqtfgqgtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'P':
    No sequence available.